PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801171.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 190aa    MW: 21465.8 Da    PI: 4.842
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801171.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.91.1e-121660145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    +rien   r++tfskRr g+ KKA+ L   C++++ + +fs+ g+
  XP_009801171.1 16 ERIENPEDRYTTFSKRRSGLYKKASNLVEECGVDIGIALFSPAGN 60
                    69****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.021868IPR002100Transcription factor, MADS-box
SMARTSM004329.5E-14867IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-18978IPR002100Transcription factor, MADS-box
CDDcd001201.44E-20967No hitNo description
PRINTSPR004041.7E-101030IPR002100Transcription factor, MADS-box
PfamPF003194.1E-181764IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-103045IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-104566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MDKEKKTEGR QSIPMERIEN PEDRYTTFSK RRSGLYKKAS NLVEECGVDI GIALFSPAGN  60
PFSFFHPTPN IFLDHFENPN IELSESTKLV AAYTRNNVNQ TNNRINEIET IEEAAKSKML  120
LLEQLNKTRQ MDSLESIDQF KTDDITKYEA WLKGAVFGLE NRLKQLENGA SSSSQAPPNN  180
ADNSPSTSNE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801171.11e-139PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_016479567.11e-139PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLM1DEL89e-61M1DEL8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000878133e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-22AGAMOUS-like 61